PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG728800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bHLH
Protein Properties Length: 124aa    MW: 13674.3 Da    PI: 5.1811
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG728800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH22.62e-0751901554
                         HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                  HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                         +i +  ++L++llP+a  +++ +   a +L+++++YI+sL
  Pavir.9NG728800.1.p 51 QISDLVSKLQDLLPEARLQSNARAPSARVLQETCNYIRSL 90
                         789999*********889********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.108.3E-935109IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.5633690IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474598.11E-949112IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.8E-45190IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MGCGCRIIGQ TNQHLDTAES DVQCEVITLR EMSSRRSRSR QSGSSRITEE QISDLVSKLQ  60
DLLPEARLQS NARAPSARVL QETCNYIRSL HQEVDDLSER LSELLATSDM SSAQAAIIHS  120
LLM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.163441e-142root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649473.11e-46PREDICTED: transcription factor ILI6
RefseqXP_006649475.11e-46PREDICTED: transcription factor ILI6
RefseqXP_015691117.11e-46PREDICTED: transcription factor ILI6
RefseqXP_015691118.11e-46PREDICTED: transcription factor ILI6
RefseqXP_015691119.11e-46PREDICTED: transcription factor ILI6
RefseqXP_015691120.11e-46PREDICTED: transcription factor ILI6
SwissprotB8APB54e-44ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR24e-44ILI6_ORYSJ; Transcription factor ILI6
TrEMBLJ3LKG82e-46J3LKG8_ORYBR; Uncharacterized protein
STRINGOB03G15440.14e-46(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.12e-29bHLH family protein